Lineage for d1u41a_ (1u41 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937487Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 937501Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
  7. 937502Species Human (Homo sapiens) [TaxId:9606] [49249] (9 PDB entries)
    Uniprot P25799 245-350
  8. 937507Domain d1u41a_: 1u41 A: [107648]
    mutant

Details for d1u41a_

PDB Entry: 1u41 (more details), 2.2 Å

PDB Description: crystal structure of ylgv mutant of dimerisation domain of nf-kb p50 transcription factor
PDB Compounds: (A:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d1u41a_:

Sequence, based on SEQRES records: (download)

>d1u41a_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]}
nlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrq
fgivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Sequence, based on observed residues (ATOM records): (download)

>d1u41a_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]}
nlkivrmdrtagcvtggeeiyllcdkvqkddiirfyeeeenggvwegfgdfsptdvhrqf
givfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

SCOPe Domain Coordinates for d1u41a_:

Click to download the PDB-style file with coordinates for d1u41a_.
(The format of our PDB-style files is described here.)

Timeline for d1u41a_: