Lineage for d1u3za_ (1u3z A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765064Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2765078Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
  7. 2765084Species Mouse (Mus musculus) [TaxId:10090] [49250] (15 PDB entries)
  8. 2765089Domain d1u3za_: 1u3z A: [107646]
    mutant

Details for d1u3za_

PDB Entry: 1u3z (more details), 1.9 Å

PDB Description: crystal structure of mlac mutant of dimerisation domain of nf-kb p50 transcription factor
PDB Compounds: (A:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d1u3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3za_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
nlkivrmdrtagcvtggeeimllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrq
faicfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

SCOPe Domain Coordinates for d1u3za_:

Click to download the PDB-style file with coordinates for d1u3za_.
(The format of our PDB-style files is described here.)

Timeline for d1u3za_: