Lineage for d1u3ya_ (1u3y A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456111Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (6 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 456115Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
  7. 456116Species Human (Homo sapiens) [TaxId:9606] [49249] (8 PDB entries)
  8. 456117Domain d1u3ya_: 1u3y A: [107645]

Details for d1u3ya_

PDB Entry: 1u3y (more details), 1.9 Å

PDB Description: crystal structure of ilac mutant of dimerisation domain of nf-kb p50 transcription factor

SCOP Domain Sequences for d1u3ya_:

Sequence, based on SEQRES records: (download)

>d1u3ya_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens)}
nlkivrmdrtagcvtggeeiillcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrq
faicfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Sequence, based on observed residues (ATOM records): (download)

>d1u3ya_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens)}
nlkivrmdrtagcvtggeeiillcdkvqkddiqirfyevwegfgdfsptdvhrqfaicfk
tpkykdvnitkpasvfvqlrrksdletsepkpflyype

SCOP Domain Coordinates for d1u3ya_:

Click to download the PDB-style file with coordinates for d1u3ya_.
(The format of our PDB-style files is described here.)

Timeline for d1u3ya_: