Lineage for d1u3pa_ (1u3p A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960358Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2960359Family d.79.5.1: IpsF-like [69766] (3 proteins)
    automatically mapped to Pfam PF02542
  6. 2960360Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)
  7. 2960374Species Escherichia coli [TaxId:562] [69768] (14 PDB entries)
    Uniprot P62617 ! Uniprot P36663
  8. 2960393Domain d1u3pa_: 1u3p A: [107644]
    complexed with zn

Details for d1u3pa_

PDB Entry: 1u3p (more details), 2.85 Å

PDB Description: IspF native
PDB Compounds: (A:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1u3pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3pa_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli [TaxId: 562]}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavalli

SCOPe Domain Coordinates for d1u3pa_:

Click to download the PDB-style file with coordinates for d1u3pa_.
(The format of our PDB-style files is described here.)

Timeline for d1u3pa_: