Lineage for d1u3la_ (1u3l A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506461Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 506680Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 506681Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein)
  6. 506682Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (3 species)
  7. 506683Species Escherichia coli [TaxId:562] [69768] (8 PDB entries)
  8. 506688Domain d1u3la_: 1u3l A: [107643]

Details for d1u3la_

PDB Entry: 1u3l (more details), 2.5 Å

PDB Description: ispf with mg and cdp

SCOP Domain Sequences for d1u3la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3la_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavalli

SCOP Domain Coordinates for d1u3la_:

Click to download the PDB-style file with coordinates for d1u3la_.
(The format of our PDB-style files is described here.)

Timeline for d1u3la_: