![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.285: DNA-binding domain of intron-encoded endonucleases [64495] (1 superfamily) beta(2)-alpha(2)-beta; 2 layers; 3-stranded antiparallel beta-sheet, order 213; HTH motif; also includes the extra N-terminal, DNA minor groove-binding helix |
![]() | Superfamily d.285.1: DNA-binding domain of intron-encoded endonucleases [64496] (1 family) ![]() |
![]() | Family d.285.1.1: DNA-binding domain of intron-encoded endonucleases [64497] (2 proteins) |
![]() | Protein Intron-encoded homing endonuclease I-HmuI [110794] (1 species) |
![]() | Species Bacteriophage SPO1 [TaxId:10685] [110795] (1 PDB entry) Uniprot P34081 |
![]() | Domain d1u3em2: 1u3e M:106-174 [107641] Other proteins in same PDB: d1u3em1 protein/DNA complex; complexed with edo, mn, sr, trs |
PDB Entry: 1u3e (more details), 2.92 Å
SCOPe Domain Sequences for d1u3em2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3em2 d.285.1.1 (M:106-174) Intron-encoded homing endonuclease I-HmuI {Bacteriophage SPO1 [TaxId: 10685]} lnvskaqqiakiknqkpiivispdgiekeypstkcaceelgltrgkvtdvlkghrihhkg ytfryklng
Timeline for d1u3em2: