Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.285: DNA-binding domain of intron-encoded endonucleases [64495] (1 superfamily) beta(2)-alpha(2)-beta; 2 layers; 3-stranded antiparallel beta-sheet, order 213; HTH motif; also includes the extra N-terminal, DNA minor groove-binding helix |
Superfamily d.285.1: DNA-binding domain of intron-encoded endonucleases [64496] (1 family) |
Family d.285.1.1: DNA-binding domain of intron-encoded endonucleases [64497] (2 proteins) |
Protein Intron-encoded homing endonuclease I-HmuI [110794] (1 species) |
Species Bacteriophage SP01 [TaxId:10685] [110795] (1 PDB entry) |
Domain d1u3em2: 1u3e M:106-174 [107641] Other proteins in same PDB: d1u3em1 complexed with egl, mn, sr, trs |
PDB Entry: 1u3e (more details), 2.92 Å
SCOP Domain Sequences for d1u3em2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3em2 d.285.1.1 (M:106-174) Intron-encoded homing endonuclease I-HmuI {Bacteriophage SP01} lnvskaqqiakiknqkpiivispdgiekeypstkcaceelgltrgkvtdvlkghrihhkg ytfryklng
Timeline for d1u3em2: