Lineage for d1u3em2 (1u3e M:106-174)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 617248Fold d.285: DNA-binding domain of intron-encoded endonucleases [64495] (1 superfamily)
    beta(2)-alpha(2)-beta; 2 layers; 3-stranded antiparallel beta-sheet, order 213; HTH motif; also includes the extra N-terminal, DNA minor groove-binding helix
  4. 617249Superfamily d.285.1: DNA-binding domain of intron-encoded endonucleases [64496] (1 family) (S)
  5. 617250Family d.285.1.1: DNA-binding domain of intron-encoded endonucleases [64497] (2 proteins)
  6. 617255Protein Intron-encoded homing endonuclease I-HmuI [110794] (1 species)
  7. 617256Species Bacteriophage SP01 [TaxId:10685] [110795] (1 PDB entry)
  8. 617257Domain d1u3em2: 1u3e M:106-174 [107641]
    Other proteins in same PDB: d1u3em1
    complexed with egl, mn, sr, trs

Details for d1u3em2

PDB Entry: 1u3e (more details), 2.92 Å

PDB Description: DNA binding and cleavage by the HNH homing endonuclease I-HmuI

SCOP Domain Sequences for d1u3em2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3em2 d.285.1.1 (M:106-174) Intron-encoded homing endonuclease I-HmuI {Bacteriophage SP01}
lnvskaqqiakiknqkpiivispdgiekeypstkcaceelgltrgkvtdvlkghrihhkg
ytfryklng

SCOP Domain Coordinates for d1u3em2:

Click to download the PDB-style file with coordinates for d1u3em2.
(The format of our PDB-style files is described here.)

Timeline for d1u3em2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u3em1