Lineage for d1u3em1 (1u3e M:1-105)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1889894Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 1889895Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 1889978Family d.4.1.3: Intron-encoded homing endonucleases [54069] (2 proteins)
  6. 1889979Protein Intron-encoded homing endonuclease I-HmuI [110776] (1 species)
  7. 1889980Species Bacteriophage SPO1 [TaxId:10685] [110777] (1 PDB entry)
    Uniprot P34081
  8. 1889981Domain d1u3em1: 1u3e M:1-105 [107640]
    Other proteins in same PDB: d1u3em2
    protein/DNA complex; complexed with edo, mn, sr, trs

Details for d1u3em1

PDB Entry: 1u3e (more details), 2.92 Å

PDB Description: DNA binding and cleavage by the HNH homing endonuclease I-HmuI
PDB Compounds: (M:) HNH homing endonuclease

SCOPe Domain Sequences for d1u3em1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3em1 d.4.1.3 (M:1-105) Intron-encoded homing endonuclease I-HmuI {Bacteriophage SPO1 [TaxId: 10685]}
mewkdikgyeghyqvsntgevysiksgktlkhqipkdgyhriglfkggkgktfqvhrlva
ihfcegyeeglvvdhkdgnkdnnlstnlrwvtqkinvenqmsrgt

SCOPe Domain Coordinates for d1u3em1:

Click to download the PDB-style file with coordinates for d1u3em1.
(The format of our PDB-style files is described here.)

Timeline for d1u3em1: