Lineage for d1u3ca1 (1u3c A:198-497)
- Root: SCOP 1.71
Class a: All alpha proteins [46456] (226 folds) 
Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
multihelical; consists of two all-alpha subdomainsSuperfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (1 family) 
Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (2 proteins) 
Protein Cryptochrome C-terminal domain [81841] (2 species) 
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [109947] (2 PDB entries) 
Domain d1u3ca1: 1u3c A:198-497 [107636]
Other proteins in same PDB: d1u3ca2
complexed with cl, fad, hez, mg, nds
Details for d1u3ca1
PDB Entry: 1u3c (more details), 2.6 Å
PDB Description: Crystal Structure of the PHR domain of Cryptochrome 1 from Arabidopsis thaliana
SCOP Domain Sequences for d1u3ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3ca1 a.99.1.1 (A:198-497) Cryptochrome C-terminal domain {Thale cress (Arabidopsis thaliana)}
eddsekgsnallarawspgwsngdkalttfingplleysknrrkadsattsflsphlhfg
evsvrkvfhlvrikqvawanegneageesvnlflksiglreysryisfnhpysherpllg
hlkffpwavdenyfkawrqgrtgyplvdagmrelwatgwlhdrirvvvssffvkvlqlpw
rwgmkyfwdtlldadlesdalgwqyitgtlpdsrefdridnpqfegykfdpngeyvrrwl
pelsrlptdwihhpwnapesvlqaagielgsnyplpivgldeakarlhealsqmwqleaa
SCOP Domain Coordinates for d1u3ca1:
Click to download the PDB-style file with coordinates for d1u3ca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1u3ca1:
- d1u3ca1 first appeared in SCOP 1.69
- d1u3ca1 appears in SCOP 1.73
- d1u3ca1 appears in the current release, SCOPe 2.08
View in 3D
