| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins) subgroup of the larger IPT/TIG domain family |
| Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [49250] (15 PDB entries) |
| Domain d1u36a_: 1u36 A: [107635] mutant |
PDB Entry: 1u36 (more details), 1.89 Å
SCOPe Domain Sequences for d1u36a_:
Sequence, based on SEQRES records: (download)
>d1u36a_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
nlkivrmdrtagcvtggeeiwllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrq
faicfktpkykdvnitkpasvfvqlrrksdletsepkpflyype
>d1u36a_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
nlkivrmdrtagcvtggeeiwllcdkvqkddiqirfyeeevwegfgdfsptdvhrqfaic
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype
Timeline for d1u36a_: