SCOPe 2.08: Domain d1u36a_: 1u36 A:

Lineage for d1u36a_ (1u36 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49250] (15 PDB entries)

8. Domain d1u36a_: 1u36 A: [107635]
   mutant

Details for d1u36a_

PDB Entry: 1u36, 1.89 Å

PDB Description: crystal structure of wlac mutant of dimerisation domain of nf-kb p50 transcription factor

PDB Compounds: (A:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d1u36a_:

Sequence, based on SEQRES records:

>d1u36a_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
nlkivrmdrtagcvtggeeiwllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrq
faicfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Sequence, based on observed residues (ATOM records):

>d1u36a_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
nlkivrmdrtagcvtggeeiwllcdkvqkddiqirfyeeevwegfgdfsptdvhrqfaic
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Timeline for d1u36a_:

• d1u36a_ first appeared in SCOP 1.69
  
• d1u36a_ appears in SCOPe 2.07