Lineage for d1u34a_ (1u34 A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 625670Fold g.76: Hormone receptor domain [111417] (1 superfamily)
    disulfide-rich all-beta fold; contains beta sandwich of 5 strands
  4. 625671Superfamily g.76.1: Hormone receptor domain [111418] (1 family) (S)
  5. 625672Family g.76.1.1: Hormone receptor domain [111419] (1 protein)
    Pfam 02793; HRM
  6. 625673Protein Corticotropin releasing factor receptor 2, CRFR-2beta [111420] (1 species)
  7. 625674Species Mouse (Mus musculus) [TaxId:10090] [111421] (1 PDB entry)
  8. 625675Domain d1u34a_: 1u34 A: [107634]

Details for d1u34a_

PDB Entry: 1u34 (more details)

PDB Description: 3d nmr structure of the first extracellular domain of crfr-2beta, a type b1 g-protein coupled receptor

SCOP Domain Sequences for d1u34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u34a_ g.76.1.1 (A:) Corticotropin releasing factor receptor 2, CRFR-2beta {Mouse (Mus musculus)}
gsgmketaaakferqhmdspdlgttlleqychrttignfsgpytycnttldqigtcwpqs
apgalverpcpeyfngikynttrnayreclengtwasrvnyshcepilddkqrkydlhy

SCOP Domain Coordinates for d1u34a_:

Click to download the PDB-style file with coordinates for d1u34a_.
(The format of our PDB-style files is described here.)

Timeline for d1u34a_: