Lineage for d1u33a1 (1u33 A:404-496)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 469403Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 469404Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 469405Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 469433Protein Animal alpha-amylase [51024] (3 species)
  7. 469434Species Human (Homo sapiens) [TaxId:9606] [51026] (23 PDB entries)
  8. 469445Domain d1u33a1: 1u33 A:404-496 [107632]
    Other proteins in same PDB: d1u33a2

Details for d1u33a1

PDB Entry: 1u33 (more details), 1.95 Å

PDB Description: in situ extension as an approach for identifying novel alpha-amylase inhibitors

SCOP Domain Sequences for d1u33a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u33a1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1u33a1:

Click to download the PDB-style file with coordinates for d1u33a1.
(The format of our PDB-style files is described here.)

Timeline for d1u33a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u33a2