![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Animal alpha-amylase [51024] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [51026] (23 PDB entries) |
![]() | Domain d1u30a1: 1u30 A:404-496 [107629] Other proteins in same PDB: d1u30a2 |
PDB Entry: 1u30 (more details), 1.9 Å
SCOP Domain Sequences for d1u30a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u30a1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)} qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct gikiyvsddgkahfsisnsaedpfiaihaeskl
Timeline for d1u30a1: