Lineage for d1u2zc_ (1u2z C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130146Family c.66.1.31: Catalytic, N-terminal domain of histone methyltransferase Dot1l [89746] (2 protein domains)
  6. 2130147Protein Catalytic, N-terminal domain of histone methyltransferase Dot1l [89747] (2 species)
    a non-SET domain nucleosomal histone methyltransferase
  7. 2130148Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110667] (1 PDB entry)
    Uniprot Q04089 176-581
  8. 2130151Domain d1u2zc_: 1u2z C: [107628]
    complexed with sah

Details for d1u2zc_

PDB Entry: 1u2z (more details), 2.2 Å

PDB Description: Crystal structure of histone K79 methyltransferase Dot1p from yeast
PDB Compounds: (C:) Histone-lysine N-methyltransferase, H3 lysine-79 specific

SCOPe Domain Sequences for d1u2zc_:

Sequence, based on SEQRES records: (download)

>d1u2zc_ c.66.1.31 (C:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sstfvdwngpclrlqyplfdieylrsheiysgtpiqsislrtnspqptsltsdndtssvt
taklqsilfsnymeeykvdfkrstaiynpmseigklieysclvflpspyaeqlketilpd
lnasfdnsdtkgfvnainlynkmireiprqriidhletidkiprsfihdflhivytrsih
pqanklkhykafsnyvygellpnflsdvyqqcqlkkgdtfmdlgsgvgncvvqaalecgc
alsfgceimddasdltilqyeelkkrcklygmrlnnvefslkksfvdnnrvaelipqcdv
ilvnnflfdedlnkkvekilqtakvgckiislkslrsltyqinfynvenifnrlkvqryd
lkedsvswthsggeyyistvmedvdeslfspaargrrnrgtpvkytr

Sequence, based on observed residues (ATOM records): (download)

>d1u2zc_ c.66.1.31 (C:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sstfvdwngpclrlqyplfdieylrsheiysgtpiqsislrtttaklqsilfsnymeeyk
vdfkrstaiynpmseigklieysclvflpspyaeqlketilpdlnasfdnsdtkgfvnai
nlynkmireiprqriidhletidkiprsfihdflhivytrsihpqanklkhykafsnyvy
gellpnflsdvyqqcqlkkgdtfmdlgsgvgncvvqaalecgcalsfgceimddasdlti
lqyeelkkrcklygmrlnnvefslkksfvdnnrvaelipqcdvilvnnflfdedlnkkve
kilqtakvgckiislkslrsltyqinfynvenifnrlkvqrydlkedsvswthsggeyyi
stvmedvdeslfspaarrtpvkytr

SCOPe Domain Coordinates for d1u2zc_:

Click to download the PDB-style file with coordinates for d1u2zc_.
(The format of our PDB-style files is described here.)

Timeline for d1u2zc_: