SCOP 1.69: Domain d1u2ya1: 1u2y A:404-496

Lineage for d1u2ya1 (1u2y A:404-496)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (23 PDB entries)

8. Domain d1u2ya1: 1u2y A:404-496 [107624]
   Other proteins in same PDB: d1u2ya2

Details for d1u2ya1

PDB Entry: 1u2y, 1.95 Å

PDB Description: in situ extension as an approach for identifying novel alpha-amylase inhibitors, structure containing d-gluconhydroximo-1,5-lactam

SCOP Domain Sequences for d1u2ya1:

Sequence; same for both SEQRES and ATOM records:

>d1u2ya1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

Timeline for d1u2ya1:

• d1u2ya1 is new in SCOP 1.69
  
• d1u2ya1 appears in SCOP 1.71
  
• d1u2ya1 appears in the current release, SCOPe 2.08