Lineage for d1u2ya1 (1u2y A:404-496)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810362Protein Animal alpha-amylase [51024] (3 species)
  7. 2810363Species Human (Homo sapiens) [TaxId:9606] [51026] (55 PDB entries)
    Uniprot P04746 16-511 ! SQ 04746
  8. 2810386Domain d1u2ya1: 1u2y A:404-496 [107624]
    Other proteins in same PDB: d1u2ya2
    complexed with ca, cl, gox, nag

Details for d1u2ya1

PDB Entry: 1u2y (more details), 1.95 Å

PDB Description: in situ extension as an approach for identifying novel alpha-amylase inhibitors, structure containing d-gluconhydroximo-1,5-lactam
PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1u2ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2ya1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d1u2ya1:

Click to download the PDB-style file with coordinates for d1u2ya1.
(The format of our PDB-style files is described here.)

Timeline for d1u2ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u2ya2