SCOP 1.69: Domain d1u2xb_: 1u2x B:

Lineage for d1u2xb_ (1u2x B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (5 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.3: ADP-specific Phosphofructokinase/Glucokinase (Pfam 04587) [64147] (2 proteins)

6. Protein ADP-specific phosphofructokinase [110707] (1 species)

7. Species Pyrococcus horikoshii [TaxId:70601] [110708] (1 PDB entry)

8. Domain d1u2xb_: 1u2x B: [107623]

Details for d1u2xb_

PDB Entry: 1u2x, 2 Å

PDB Description: Crystal Structure of a Hypothetical ADP-dependent Phosphofructokinase from Pyrococcus horikoshii OT3

SCOP Domain Sequences for d1u2xb_:

Sequence; same for both SEQRES and ATOM records:

>d1u2xb_ c.72.1.3 (B:) ADP-specific phosphofructokinase {Pyrococcus horikoshii}
mipehlsiytaynanidaivklnqetiqnlinafdpdevkrrieeypreinepidfvarl
vhtlklgkpaavplvnekmnewfdktfryeeerlggqagiiantlaglkirkviaytpfl
pkrlaelfkkgvlypvvengelqfkpiqeayregdplkinrifefrkglkfklgdetiei
pnsgrfivsarfesisrietredikpflgeigkevdgaifsgyqglrtkysdgkdanyyl
rrakediiefkekdvkihvefasvqdrklrkkiitnilpfvdsvgideaeiaqilsvlgy
reladriftynrledsilggmiildelnfeilqvhttyylmyithrdnplseeelaksle
fgttlaaaraslgdirgpddykvglkvpfnerseyvklrfeeaksrlrmreykvvviptr
lvqnpvltvglgdtisagafltyleflkrh

Timeline for d1u2xb_:

• d1u2xb_ is new in SCOP 1.69
  
• d1u2xb_ appears in SCOP 1.71
  
• d1u2xb_ appears in the current release, SCOPe 2.08