Lineage for d1u2ra4 (1u2r A:482-560)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504884Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 504885Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 504886Protein Elongation factor 2 (eEF-2) [82677] (1 species)
  7. 504887Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (3 PDB entries)
  8. 504890Domain d1u2ra4: 1u2r A:482-560 [107620]
    Other proteins in same PDB: d1u2ra1, d1u2ra2, d1u2ra3

Details for d1u2ra4

PDB Entry: 1u2r (more details), 2.6 Å

PDB Description: Crystal Structure of ADP-ribosylated Ribosomal Translocase from Saccharomyces cerevisiae

SCOP Domain Sequences for d1u2ra4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2ra4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae)}
kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic
lqdlehdhagvplkisppv

SCOP Domain Coordinates for d1u2ra4:

Click to download the PDB-style file with coordinates for d1u2ra4.
(The format of our PDB-style files is described here.)

Timeline for d1u2ra4: