Lineage for d1u2oa_ (1u2o A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924588Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1924589Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1924590Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 1924591Protein HSP90 [55876] (3 species)
  7. 1924632Species Dog (Canis familiaris) [TaxId:9615] [103225] (22 PDB entries)
    Uniprot P41148 76-285; Endoplasmin, GRP94
  8. 1924647Domain d1u2oa_: 1u2o A: [107615]
    complexed with 1pe, nec, pg4

Details for d1u2oa_

PDB Entry: 1u2o (more details), 2.1 Å

PDB Description: crystal structure of the n-domain of grp94 lacking the charged domain in complex with neca
PDB Compounds: (A:) Endoplasmin

SCOPe Domain Sequences for d1u2oa_:

Sequence, based on SEQRES records: (download)

>d1u2oa_ d.122.1.1 (A:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d1u2oa_ d.122.1.1 (A:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtigtseflnkmteaqestse
ligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlv
lkeeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn

SCOPe Domain Coordinates for d1u2oa_:

Click to download the PDB-style file with coordinates for d1u2oa_.
(The format of our PDB-style files is described here.)

Timeline for d1u2oa_: