Lineage for d1u2oa_ (1u2o A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510439Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 510440Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 510441Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein)
  6. 510442Protein HSP90 [55876] (3 species)
  7. 510452Species Dog (Canis familiaris) [TaxId:9615] [103225] (7 PDB entries)
  8. 510458Domain d1u2oa_: 1u2o A: [107615]

Details for d1u2oa_

PDB Entry: 1u2o (more details), 2.1 Å

PDB Description: crystal structure of the n-domain of grp94 lacking the charged domain in complex with neca

SCOP Domain Sequences for d1u2oa_:

Sequence, based on SEQRES records: (download)

>d1u2oa_ d.122.1.1 (A:) HSP90 {Dog (Canis familiaris)}
gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d1u2oa_ d.122.1.1 (A:) HSP90 {Dog (Canis familiaris)}
gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtigtseflnkmteaqestse
ligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlv
lkeeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn

SCOP Domain Coordinates for d1u2oa_:

Click to download the PDB-style file with coordinates for d1u2oa_.
(The format of our PDB-style files is described here.)

Timeline for d1u2oa_: