Lineage for d1u2mc1 (1u2m C:21-161)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256305Fold f.48: OmpH-like [111383] (1 superfamily)
    trimer; one subunit consists of an alpha/beta oligomerization subdomain [3-stranded parallel beta-sheet, order 213], and an antiparallel coiled coil
  4. 2256306Superfamily f.48.1: OmpH-like [111384] (1 family) (S)
    automatically mapped to Pfam PF03938
  5. 2256307Family f.48.1.1: OmpH-like [111385] (1 protein)
    Pfam PF03938
  6. 2256308Protein Periplasmic chaperon skp (HlpA) [111386] (1 species)
  7. 2256309Species Escherichia coli [TaxId:562] [111387] (2 PDB entries)
    Uniprot P11457
  8. 2256312Domain d1u2mc1: 1u2m C:21-161 [107614]
    Other proteins in same PDB: d1u2ma2, d1u2mc2

Details for d1u2mc1

PDB Entry: 1u2m (more details), 2.3 Å

PDB Description: crystal structure of skp
PDB Compounds: (C:) Histone-like protein HLP-1

SCOPe Domain Sequences for d1u2mc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2mc1 f.48.1.1 (C:21-161) Periplasmic chaperon skp (HlpA) {Escherichia coli [TaxId: 562]}
adkiaivnmgslfqqvaqktgvsntlenefkgraselqrmetdlqakmkklqsmkagsdr
tklekdvmaqrqtfaqkaqafeqdrarrsneergklvtriqtavksvansqdidlvvdan
avaynssdvkditadvlkqvk

SCOPe Domain Coordinates for d1u2mc1:

Click to download the PDB-style file with coordinates for d1u2mc1.
(The format of our PDB-style files is described here.)

Timeline for d1u2mc1: