Lineage for d1u2mc_ (1u2m C:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 520824Fold f.48: OmpH-like (Pfam 03938) [111383] (1 superfamily)
    trimer; one subunit consists of an alpha/beta oligomerization subdomain [3-stranded parallel beta-sheet, order 213], and an antiparallel coiled coil
  4. 520825Superfamily f.48.1: OmpH-like (Pfam 03938) [111384] (1 family) (S)
  5. 520826Family f.48.1.1: OmpH-like (Pfam 03938) [111385] (1 protein)
  6. 520827Protein Periplasmic chaperon skp (HlpA) [111386] (1 species)
  7. 520828Species Escherichia coli [TaxId:562] [111387] (2 PDB entries)
  8. 520831Domain d1u2mc_: 1u2m C: [107614]

Details for d1u2mc_

PDB Entry: 1u2m (more details), 2.3 Å

PDB Description: crystal structure of skp

SCOP Domain Sequences for d1u2mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2mc_ f.48.1.1 (C:) Periplasmic chaperon skp (HlpA) {Escherichia coli}
gmadkiaivnmgslfqqvaqktgvsntlenefkgraselqrmetdlqakmkklqsmkags
drtklekdvmaqrqtfaqkaqafeqdrarrsneergklvtriqtavksvansqdidlvvd
anavaynssdvkditadvlkqvk

SCOP Domain Coordinates for d1u2mc_:

Click to download the PDB-style file with coordinates for d1u2mc_.
(The format of our PDB-style files is described here.)

Timeline for d1u2mc_: