SCOPe 2.06: Domain d1u2ca2: 1u2c A:179-303

Lineage for d1u2ca2 (1u2c A:179-303)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.272: Dystroglycan, domain 2 [111005] (1 superfamily)
   beta-alpha-beta-X-beta(2)-alpha(2)-beta; antiparallel beta-sheet, order 24153; topological similarity to the ferredoxin-like fold (54861)

4. Superfamily d.272.1: Dystroglycan, domain 2 [111006] (1 family)

5. Family d.272.1.1: Dystroglycan, domain 2 [111007] (2 proteins)

6. Protein Dystroglycan, domain 2 [111008] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111009] (1 PDB entry)
   Uniprot Q62165 58-303

8. Domain d1u2ca2: 1u2c A:179-303 [107611]
   Other proteins in same PDB: d1u2ca1

Details for d1u2ca2

PDB Entry: 1u2c, 2.3 Å

PDB Description: Crystal Structure of a-dystroglycan

PDB Compounds: (A:) Dystroglycan

SCOPe Domain Sequences for d1u2ca2:

Sequence; same for both SEQRES and ATOM records:

>d1u2ca2 d.272.1.1 (A:179-303) Dystroglycan, domain 2 {Mouse (Mus musculus) [TaxId: 10090]}
acaadepvtvltvildadltkmtpkqridllnrmqsfsevelhnmklvpvvnnrlfdmsa
fmagpgnakkvvengallswklgcslnqnsvpdirgvetparegamsaqlgypvvgwhia
nkkpt

Timeline for d1u2ca2:

• d1u2ca2 first appeared in SCOP 1.69
  
• d1u2ca2 appears in SCOPe 2.05
  
• d1u2ca2 appears in SCOPe 2.07
  
• d1u2ca2 appears in the current release, SCOPe 2.08