Lineage for d1u2ca2 (1u2c A:179-303)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1946901Fold d.272: Dystroglycan, domain 2 [111005] (1 superfamily)
    beta-alpha-beta-X-beta(2)-alpha(2)-beta; antiparallel beta-sheet, order 24153; topological similarity to the ferredoxin-like fold (54861)
  4. 1946902Superfamily d.272.1: Dystroglycan, domain 2 [111006] (1 family) (S)
  5. 1946903Family d.272.1.1: Dystroglycan, domain 2 [111007] (2 proteins)
  6. 1946904Protein Dystroglycan, domain 2 [111008] (1 species)
  7. 1946905Species Mouse (Mus musculus) [TaxId:10090] [111009] (1 PDB entry)
    Uniprot Q62165 58-303
  8. 1946906Domain d1u2ca2: 1u2c A:179-303 [107611]
    Other proteins in same PDB: d1u2ca1

Details for d1u2ca2

PDB Entry: 1u2c (more details), 2.3 Å

PDB Description: Crystal Structure of a-dystroglycan
PDB Compounds: (A:) Dystroglycan

SCOPe Domain Sequences for d1u2ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2ca2 d.272.1.1 (A:179-303) Dystroglycan, domain 2 {Mouse (Mus musculus) [TaxId: 10090]}
acaadepvtvltvildadltkmtpkqridllnrmqsfsevelhnmklvpvvnnrlfdmsa
fmagpgnakkvvengallswklgcslnqnsvpdirgvetparegamsaqlgypvvgwhia
nkkpt

SCOPe Domain Coordinates for d1u2ca2:

Click to download the PDB-style file with coordinates for d1u2ca2.
(The format of our PDB-style files is described here.)

Timeline for d1u2ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u2ca1