![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.272: Dystroglycan, domain 2 [111005] (1 superfamily) beta-alpha-beta-X-beta(2)-alpha(2)-beta; antiparallel beta-sheet, order 24153; topological similarity to the ferredoxin-like fold (54861) |
![]() | Superfamily d.272.1: Dystroglycan, domain 2 [111006] (1 family) ![]() |
![]() | Family d.272.1.1: Dystroglycan, domain 2 [111007] (2 proteins) |
![]() | Protein Dystroglycan, domain 2 [111008] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [111009] (1 PDB entry) Uniprot Q62165 58-303 |
![]() | Domain d1u2ca2: 1u2c A:179-303 [107611] Other proteins in same PDB: d1u2ca1 |
PDB Entry: 1u2c (more details), 2.3 Å
SCOPe Domain Sequences for d1u2ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2ca2 d.272.1.1 (A:179-303) Dystroglycan, domain 2 {Mouse (Mus musculus) [TaxId: 10090]} acaadepvtvltvildadltkmtpkqridllnrmqsfsevelhnmklvpvvnnrlfdmsa fmagpgnakkvvengallswklgcslnqnsvpdirgvetparegamsaqlgypvvgwhia nkkpt
Timeline for d1u2ca2: