Lineage for d1u2ca1 (1u2c A:58-160)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037192Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2037287Family b.1.6.2: Dystroglycan, N-terminal domain [110062] (2 proteins)
  6. 2037288Protein Dystroglycan, N-terminal domain [110063] (1 species)
  7. 2037289Species Mouse (Mus musculus) [TaxId:10090] [110064] (1 PDB entry)
    Uniprot Q62165 58-303
  8. 2037290Domain d1u2ca1: 1u2c A:58-160 [107610]
    Other proteins in same PDB: d1u2ca2

Details for d1u2ca1

PDB Entry: 1u2c (more details), 2.3 Å

PDB Description: Crystal Structure of a-dystroglycan
PDB Compounds: (A:) Dystroglycan

SCOPe Domain Sequences for d1u2ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
avptvvgipdgtavvgrsfrvsiptdliassgeiikvsaagkealpswlhwdphshileg
lpldtdkgvhyisvsaarlgangshvpqtssvfsievypedhn

SCOPe Domain Coordinates for d1u2ca1:

Click to download the PDB-style file with coordinates for d1u2ca1.
(The format of our PDB-style files is described here.)

Timeline for d1u2ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u2ca2