SCOPe 2.05: Domain d1u2ca1: 1u2c A:58-160

Lineage for d1u2ca1 (1u2c A:58-160)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.2: Dystroglycan, N-terminal domain [110062] (2 proteins)

6. Protein Dystroglycan, N-terminal domain [110063] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [110064] (1 PDB entry)
   Uniprot Q62165 58-303

8. Domain d1u2ca1: 1u2c A:58-160 [107610]
   Other proteins in same PDB: d1u2ca2

Details for d1u2ca1

PDB Entry: 1u2c, 2.3 Å

PDB Description: Crystal Structure of a-dystroglycan

PDB Compounds: (A:) Dystroglycan

SCOPe Domain Sequences for d1u2ca1:

Sequence; same for both SEQRES and ATOM records:

>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
avptvvgipdgtavvgrsfrvsiptdliassgeiikvsaagkealpswlhwdphshileg
lpldtdkgvhyisvsaarlgangshvpqtssvfsievypedhn

Timeline for d1u2ca1:

• d1u2ca1 first appeared in SCOP 1.69
  
• d1u2ca1 appears in SCOPe 2.04
  
• d1u2ca1 appears in SCOPe 2.06
  
• d1u2ca1 appears in the current release, SCOPe 2.08