Lineage for d1u2ca1 (1u2c A:58-160)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 455588Superfamily b.1.6: Cadherin-like [49313] (2 families) (S)
  5. 455622Family b.1.6.2: Dystroglycan, N-terminal domain [110062] (1 protein)
  6. 455623Protein Dystroglycan, N-terminal domain [110063] (1 species)
  7. 455624Species Mouse (Mus musculus) [TaxId:10090] [110064] (1 PDB entry)
  8. 455625Domain d1u2ca1: 1u2c A:58-160 [107610]
    Other proteins in same PDB: d1u2ca2

Details for d1u2ca1

PDB Entry: 1u2c (more details), 2.3 Å

PDB Description: Crystal Structure of a-dystroglycan

SCOP Domain Sequences for d1u2ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus)}
avptvvgipdgtavvgrsfrvsiptdliassgeiikvsaagkealpswlhwdphshileg
lpldtdkgvhyisvsaarlgangshvpqtssvfsievypedhn

SCOP Domain Coordinates for d1u2ca1:

Click to download the PDB-style file with coordinates for d1u2ca1.
(The format of our PDB-style files is described here.)

Timeline for d1u2ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u2ca2