Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) |
Family b.1.6.2: Dystroglycan, N-terminal domain [110062] (2 proteins) |
Protein Dystroglycan, N-terminal domain [110063] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [110064] (1 PDB entry) Uniprot Q62165 58-303 |
Domain d1u2ca1: 1u2c A:58-160 [107610] Other proteins in same PDB: d1u2ca2 |
PDB Entry: 1u2c (more details), 2.3 Å
SCOPe Domain Sequences for d1u2ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} avptvvgipdgtavvgrsfrvsiptdliassgeiikvsaagkealpswlhwdphshileg lpldtdkgvhyisvsaarlgangshvpqtssvfsievypedhn
Timeline for d1u2ca1: