Lineage for d1u1ze_ (1u1z E:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858962Family d.38.1.6: FabZ-like [110902] (1 protein)
  6. 858963Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (2 species)
  7. 858973Species Pseudomonas aeruginosa [TaxId:287] [110904] (1 PDB entry)
    Uniprot Q9HXY7
  8. 858978Domain d1u1ze_: 1u1z E: [107606]

Details for d1u1ze_

PDB Entry: 1u1z (more details), 2.5 Å

PDB Description: The Structure of (3R)-hydroxyacyl-ACP dehydratase (FabZ)
PDB Compounds: (E:) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase

SCOP Domain Sequences for d1u1ze_:

Sequence, based on SEQRES records: (download)

>d1u1ze_ d.38.1.6 (E:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]}
mmdineireylphrypfllvdrvveldiegkrirayknvsinepffnghfpehpimpgvl
iieamaqaagilgfkmldvkpadgtlyyfvgsdklrfrqpvlpgdqlqlhakfisvkrsi
wkfdchatvddkpvcsaeiicaerkl

Sequence, based on observed residues (ATOM records): (download)

>d1u1ze_ d.38.1.6 (E:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]}
mmdineireylphrypfllvdrvveldiegkrirayknvsinepffnghfpehpimpgvl
iieamaqaagilgfkmldvkpagtlyyfvgsdklrfrqpvlpgdqlqlhakfisvkrsiw
kfdchatvddkpvcsaeiicaerkl

SCOP Domain Coordinates for d1u1ze_:

Click to download the PDB-style file with coordinates for d1u1ze_.
(The format of our PDB-style files is described here.)

Timeline for d1u1ze_: