Lineage for d1u1zd_ (1u1z D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2188225Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 2188226Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 2188435Species Pseudomonas aeruginosa [TaxId:287] [110904] (1 PDB entry)
    Uniprot Q9HXY7
  8. 2188439Domain d1u1zd_: 1u1z D: [107605]
    Other proteins in same PDB: d1u1zc2
    complexed with so4

Details for d1u1zd_

PDB Entry: 1u1z (more details), 2.5 Å

PDB Description: The Structure of (3R)-hydroxyacyl-ACP dehydratase (FabZ)
PDB Compounds: (D:) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase

SCOPe Domain Sequences for d1u1zd_:

Sequence, based on SEQRES records: (download)

>d1u1zd_ d.38.1.6 (D:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]}
mmdineireylphrypfllvdrvveldiegkrirayknvsinepffnghfpehpimpgvl
iieamaqaagilgfkmldvkpadgtlyyfvgsdklrfrqpvlpgdqlqlhakfisvkrsi
wkfdchatvddkpvcsaeiicaerkl

Sequence, based on observed residues (ATOM records): (download)

>d1u1zd_ d.38.1.6 (D:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]}
mmdineireylphrypfllvdrvveldiegkrirayknvsinepffnghfpehpimpgvl
iieamaqaagilgfkmldvkpgtlyyfvgsdklrfrqpvlpgdqlqlhakfisvkrsiwk
fdchatvddkpvcsaeiicaerkl

SCOPe Domain Coordinates for d1u1zd_:

Click to download the PDB-style file with coordinates for d1u1zd_.
(The format of our PDB-style files is described here.)

Timeline for d1u1zd_: