Lineage for d1u1zb_ (1u1z B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502577Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 502578Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families) (S)
  5. 502712Family d.38.1.6: FabZ-like [110902] (1 protein)
  6. 502713Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (1 species)
  7. 502714Species Pseudomonas aeruginosa [TaxId:287] [110904] (1 PDB entry)
  8. 502716Domain d1u1zb_: 1u1z B: [107603]

Details for d1u1zb_

PDB Entry: 1u1z (more details), 2.5 Å

PDB Description: The Structure of (3R)-hydroxyacyl-ACP dehydratase (FabZ)

SCOP Domain Sequences for d1u1zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1zb_ d.38.1.6 (B:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa}
mmdineireylphrypfllvdrvveldiegkrirayknvsinepffnghfpehpimpgvl
iieamaqaagilgfkmldvkpadgtlyyfvgsdklrfrqpvlpgdqlqlhakfisvkrsi
wkfdchatvddkpvcsaeiicaerkl

SCOP Domain Coordinates for d1u1zb_:

Click to download the PDB-style file with coordinates for d1u1zb_.
(The format of our PDB-style files is described here.)

Timeline for d1u1zb_: