Lineage for d1u1ja1 (1u1j A:2-395)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089841Superfamily c.1.22: UROD/MetE-like [51726] (3 families) (S)
  5. 2089877Family c.1.22.2: Cobalamin-independent methionine synthase [110384] (1 protein)
    Pfam PF01717; duplication; consists of two related domains
  6. 2089878Protein 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase MetE [110385] (1 species)
  7. 2089879Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110386] (4 PDB entries)
    Uniprot O50008
  8. 2089880Domain d1u1ja1: 1u1j A:2-395 [107590]
    complexed with c2f, met, so4, zn

Details for d1u1ja1

PDB Entry: 1u1j (more details), 2.4 Å

PDB Description: A. thaliana cobalamine independent methionine synthase
PDB Compounds: (A:) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase

SCOPe Domain Sequences for d1u1ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1ja1 c.1.22.2 (A:2-395) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase MetE {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ashivgyprmgpkrelkfalesfwdgkstaedlqkvsadlrssiwkqmsaagtkfipsnt
fahydqvldttamlgavpprygytggeigldvyfsmargnasvpamemtkwfdtnyhyiv
pelgpevnfsyashkavneykeakalgvdtvpvlvgpvsylllskaakgvdksfellsll
pkilpiykevitelkaagatwiqldepvlvmdlegqklqaftgayaelestlsglnvlve
tyfadipaeayktltslkgvtafgfdlvrgtktldlvkagfpegkylfagvvdgrniwan
dfaaslstlqalegivgkdklvvstscsllhtavdlinetklddeikswmafaaqkvvev
nalakalagqkdealfsanaaalasrrssprvtn

SCOPe Domain Coordinates for d1u1ja1:

Click to download the PDB-style file with coordinates for d1u1ja1.
(The format of our PDB-style files is described here.)

Timeline for d1u1ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u1ja2