Lineage for d1u1id1 (1u1i D:1201-1427,D:1533-1592)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 477749Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 478095Protein Myo-inositol 1-phosphate synthase [75105] (4 species)
  7. 478096Species Archaeoglobus fulgidus [TaxId:2234] [110418] (1 PDB entry)
  8. 478100Domain d1u1id1: 1u1i D:1201-1427,D:1533-1592 [107588]
    Other proteins in same PDB: d1u1ia2, d1u1ib2, d1u1ic2, d1u1id2

Details for d1u1id1

PDB Entry: 1u1i (more details), 1.9 Å

PDB Description: myo-inositol phosphate synthase mips from a. fulgidus

SCOP Domain Sequences for d1u1id1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1id1 c.2.1.3 (D:1201-1427,D:1533-1592) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus}
mkvwlvgaygivsttamvgaraiergiapkiglvselphfegiekyapfsfefggheirl
lsnayeaakehwelnrhfdreileavksdlegivarkgtalncgsgikelgdiktlegeg
lslaemvsrieediksfaddetvvinvasteplpnyseeyhgslegfermidedrkeyas
asmlyayaalklglpyanftpspgsaipalkelaekkgvphagndgkXaivaaplildia
rfllfakkkgvkgvvkemafffkspmdtnvintheqfvvlkewysnlk

SCOP Domain Coordinates for d1u1id1:

Click to download the PDB-style file with coordinates for d1u1id1.
(The format of our PDB-style files is described here.)

Timeline for d1u1id1: