Lineage for d1u1ic2 (1u1i C:1028-1132)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606541Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 606542Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 606790Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 606857Protein Myo-inositol 1-phosphate synthase [75484] (4 species)
  7. 606858Species Archaeoglobus fulgidus [TaxId:2234] [111049] (1 PDB entry)
  8. 606861Domain d1u1ic2: 1u1i C:1028-1132 [107587]
    Other proteins in same PDB: d1u1ia1, d1u1ib1, d1u1ic1, d1u1id1

Details for d1u1ic2

PDB Entry: 1u1i (more details), 1.9 Å

PDB Description: myo-inositol phosphate synthase mips from a. fulgidus

SCOP Domain Sequences for d1u1ic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1ic2 d.81.1.3 (C:1028-1132) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus}
tgetlvkttlapmfayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlg
yspysiteiqyfpslvdnktafdfvhfkgflgklmkfyfiwdaid

SCOP Domain Coordinates for d1u1ic2:

Click to download the PDB-style file with coordinates for d1u1ic2.
(The format of our PDB-style files is described here.)

Timeline for d1u1ic2: