![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
![]() | Protein Myo-inositol 1-phosphate synthase [75484] (4 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [111049] (1 PDB entry) |
![]() | Domain d1u1ic2: 1u1i C:1028-1132 [107587] Other proteins in same PDB: d1u1ia1, d1u1ib1, d1u1ic1, d1u1id1 |
PDB Entry: 1u1i (more details), 1.9 Å
SCOP Domain Sequences for d1u1ic2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u1ic2 d.81.1.3 (C:1028-1132) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus} tgetlvkttlapmfayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlg yspysiteiqyfpslvdnktafdfvhfkgflgklmkfyfiwdaid
Timeline for d1u1ic2: