![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
![]() | Protein Myo-inositol 1-phosphate synthase [75484] (4 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [111049] (3 PDB entries) Uniprot O28480 |
![]() | Domain d1u1ib2: 1u1i B:628-732 [107585] Other proteins in same PDB: d1u1ia1, d1u1ib1, d1u1ic1, d1u1id1 complexed with k, nad, po4 |
PDB Entry: 1u1i (more details), 1.9 Å
SCOPe Domain Sequences for d1u1ib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u1ib2 d.81.1.3 (B:628-732) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus [TaxId: 2234]} tgetlvkttlapmfayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlg yspysiteiqyfpslvdnktafdfvhfkgflgklmkfyfiwdaid
Timeline for d1u1ib2: