SCOPe 2.06: Domain d1u1ia2: 1u1i A:228-332

Lineage for d1u1ia2 (1u1i A:228-332)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)

6. Protein Myo-inositol 1-phosphate synthase [75484] (4 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [111049] (3 PDB entries)
   Uniprot O28480

8. Domain d1u1ia2: 1u1i A:228-332 [107583]
   Other proteins in same PDB: d1u1ia1, d1u1ib1, d1u1ic1, d1u1id1
   complexed with k, nad, po4

Details for d1u1ia2

PDB Entry: 1u1i, 1.9 Å

PDB Description: myo-inositol phosphate synthase mips from a. fulgidus

PDB Compounds: (A:) myo-inositol-1-phosphate synthase

SCOPe Domain Sequences for d1u1ia2:

Sequence; same for both SEQRES and ATOM records:

>d1u1ia2 d.81.1.3 (A:228-332) Myo-inositol 1-phosphate synthase {Archaeoglobus fulgidus [TaxId: 2234]}
tgetlvkttlapmfayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlg
yspysiteiqyfpslvdnktafdfvhfkgflgklmkfyfiwdaid

Timeline for d1u1ia2:

• d1u1ia2 first appeared in SCOP 1.69
  
• d1u1ia2 appears in SCOPe 2.05
  
• d1u1ia2 appears in SCOPe 2.07
  
• d1u1ia2 appears in the current release, SCOPe 2.08