SCOPe 2.06: Domain d1u14a1: 1u14 A:1-168

Lineage for d1u14a1 (1u14 A:1-168)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.3: YjjX-like [110621] (2 proteins)
   Pfam PF01931

6. Protein Hypothetical protein YjjX [110622] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [110623] (1 PDB entry)
   Uniprot P39432

8. Domain d1u14a1: 1u14 A:1-168 [107579]
   Other proteins in same PDB: d1u14a2
   Structural genomics target
   complexed with po4

Details for d1u14a1

PDB Entry: 1u14, 1.68 Å

PDB Description: The crystal structure of hypothetical UPF0244 protein yjjX at resolution 1.68 Angstrom

PDB Compounds: (A:) Hypothetical UPF0244 protein yjjX

SCOPe Domain Sequences for d1u14a1:

Sequence; same for both SEQRES and ATOM records:

>d1u14a1 c.51.4.3 (A:1-168) Hypothetical protein YjjX {Salmonella typhimurium [TaxId: 90371]}
mhqvisattnpakiqailqafeeifgegschitpvavesgvpeqpfgseetragarnrvd
narrlhpqadfwvaieagidddatfswvvidngvqrgearsatlplpavildrvrqgeal
gpvmsqytgideigrkegaigvftagkltrssvyyqavilalspfhna

Timeline for d1u14a1:

• d1u14a1 first appeared in SCOP 1.69, called d1u14a_
  
• d1u14a1 was called d1u14a_ in SCOPe 2.05
  
• d1u14a1 appears in SCOPe 2.07
  
• d1u14a1 appears in the current release, SCOPe 2.08