Lineage for d1u13a_ (1u13 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446992Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 446993Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 446994Family a.104.1.1: Cytochrome P450 [48265] (20 proteins)
  6. 447024Protein Cytochrome p450 14 alpha-sterol demethylase (cyp51) [48276] (1 species)
  7. 447025Species Mycobacterium tuberculosis [TaxId:1773] [48277] (4 PDB entries)
  8. 447027Domain d1u13a_: 1u13 A: [107578]

Details for d1u13a_

PDB Entry: 1u13 (more details), 2.01 Å

PDB Description: crystal structure analysis of the c37l/c151t/c442a-triple mutant of cyp51 from mycobacterium tuberculosis

SCOP Domain Sequences for d1u13a_:

Sequence, based on SEQRES records: (download)

>d1u13a_ a.104.1.1 (A:) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedqv
rrmiadwgeageidlldffaeltiytssatligkkfrdqldgrfaklyhelergtdplay
vdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtprf
sadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhal
rqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpd
phdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaq
ppesyrndhskmvvqlaqpaavryrrrt

Sequence, based on observed residues (ATOM records): (download)

>d1u13a_ a.104.1.1 (A:) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis}
savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgrrkemlhnaalrgeqmkghaatiedqvrrmiadwgea
geidlldffaeltiytssatligkkfrdqldgrfaklyhelergtdplayvdpylpiesf
rrrdearnglvalvadimngrianpdrdmldvliavkaetgtprfsadeitgmfismmfa
ghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlr
lhppliilmrvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqe
dllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvq
laqpaavryrrrt

SCOP Domain Coordinates for d1u13a_:

Click to download the PDB-style file with coordinates for d1u13a_.
(The format of our PDB-style files is described here.)

Timeline for d1u13a_: