Lineage for d1u11b_ (1u11 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2116261Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2116262Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins)
    automatically mapped to Pfam PF00731
  6. 2116263Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (4 species)
  7. 2116264Species Acetobacter aceti [TaxId:435] [110480] (11 PDB entries)
    Uniprot Q72LC1
  8. 2116266Domain d1u11b_: 1u11 B: [107577]
    complexed with cit

Details for d1u11b_

PDB Entry: 1u11 (more details), 1.55 Å

PDB Description: PurE (N5-carboxyaminoimidazole Ribonucleotide Mutase) from the acidophile Acetobacter aceti
PDB Compounds: (B:) PurE (N5-carboxyaminoimidazole Ribonucleotide Mutase)

SCOPe Domain Sequences for d1u11b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u11b_ c.23.8.1 (B:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]}
aasapvvgiimgsqsdwetmrhadallteleiphetlivsahrtpdrladyartaaergl
nviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaiga
sgaknaallaasilalynpalaarletwralqtasvpnspite

SCOPe Domain Coordinates for d1u11b_:

Click to download the PDB-style file with coordinates for d1u11b_.
(The format of our PDB-style files is described here.)

Timeline for d1u11b_:

Domains from other chains:
(mouse over for more information)
d1u11a_