Lineage for d1u11b_ (1u11 B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481573Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (1 family) (S)
  5. 481574Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (1 protein)
  6. 481575Protein N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52257] (3 species)
  7. 481576Species Acetobacter aceti [TaxId:435] [110480] (1 PDB entry)
  8. 481578Domain d1u11b_: 1u11 B: [107577]

Details for d1u11b_

PDB Entry: 1u11 (more details), 1.55 Å

PDB Description: PurE (N5-carboxyaminoimidazole Ribonucleotide Mutase) from the acidophile Acetobacter aceti

SCOP Domain Sequences for d1u11b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u11b_ c.23.8.1 (B:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti}
aasapvvgiimgsqsdwetmrhadallteleiphetlivsahrtpdrladyartaaergl
nviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaiga
sgaknaallaasilalynpalaarletwralqtasvpnspite

SCOP Domain Coordinates for d1u11b_:

Click to download the PDB-style file with coordinates for d1u11b_.
(The format of our PDB-style files is described here.)

Timeline for d1u11b_: