Lineage for d1u10c_ (1u10 C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. Family d.65.1.3: MepA-like [111019] (1 protein)
    automatically mapped to Pfam PF03411
  6. Protein D-alanyl-D-alanine-endopeptidase MepA [111020] (1 species)
  7. Species Escherichia coli [TaxId:562] [111021] (2 PDB entries)
    Uniprot P14007
  8. Domain d1u10c_: 1u10 C: [107572]
    complexed with so4, zn

Details for d1u10c_

PDB Entry: 1u10 (more details), 2.4 Å

PDB Description: MEPA, active form with ZN in P1
PDB Compounds: (C:) Penicillin-insensitive murein endopeptidase

SCOPe Domain Sequences for d1u10c_:

Sequence, based on SEQRES records: (download)

>d1u10c_ d.65.1.3 (C:) D-alanyl-D-alanine-endopeptidase MepA {Escherichia coli [TaxId: 562]}
atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
plppscqalldehvi

Sequence, based on observed residues (ATOM records): (download)

>d1u10c_ d.65.1.3 (C:) D-alanyl-D-alanine-endopeptidase MepA {Escherichia coli [TaxId: 562]}
atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfepplppscqalldehv
i

SCOPe Domain Coordinates for d1u10c_ are not available.

Timeline for d1u10c_:

Domains from other chains:
(mouse over for more information)
d1u10a_, d1u10b_, d1u10d_, d1u10e_, d1u10f_