Lineage for d1u10a_ (1u10 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605354Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 605355Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (4 families) (S)
    zinc-binding motif
  5. 605364Family d.65.1.3: MepA-like [111019] (1 protein)
  6. 605365Protein D-alanyl-D-alanine-endopeptidase MepA [111020] (1 species)
  7. 605366Species Escherichia coli [TaxId:562] [111021] (2 PDB entries)
  8. 605369Domain d1u10a_: 1u10 A: [107570]

Details for d1u10a_

PDB Entry: 1u10 (more details), 2.4 Å

PDB Description: MEPA, active form with ZN in P1

SCOP Domain Sequences for d1u10a_:

Sequence, based on SEQRES records: (download)

>d1u10a_ d.65.1.3 (A:) D-alanyl-D-alanine-endopeptidase MepA {Escherichia coli}
atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
plppscqalld

Sequence, based on observed residues (ATOM records): (download)

>d1u10a_ d.65.1.3 (A:) D-alanyl-D-alanine-endopeptidase MepA {Escherichia coli}
atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
rlssqvsnlgmgtvligdmgmpaggrghashqtgldvdiflqlpktrwtsaqllrpqald
lvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrkvrp
wfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfelppscqalld

SCOP Domain Coordinates for d1u10a_:

Click to download the PDB-style file with coordinates for d1u10a_.
(The format of our PDB-style files is described here.)

Timeline for d1u10a_: