Lineage for d1u0tb_ (1u0t B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2626064Fold e.52: NAD kinase/diacylglycerol kinase-like [111330] (1 superfamily)
    2 domains: d1 [alpha/beta; related to the PFK N-terminal domain (53784)]; d2 [all-beta; atypical beta-sandwich made of 4 structural repeats of beta(3) unit]
  4. 2626065Superfamily e.52.1: NAD kinase/diacylglycerol kinase-like [111331] (3 families) (S)
  5. 2626066Family e.52.1.1: NAD kinase-like [111332] (1 protein)
    Pfam PF01513
  6. 2626067Protein Inorganic polyphosphate/ATP-NAD kinase PpnK [111333] (2 species)
  7. 2626083Species Mycobacterium tuberculosis [TaxId:1773] [111335] (4 PDB entries)
    Uniprot O33196; d1:5-132; d2:140-275
  8. 2626085Domain d1u0tb_: 1u0t B: [107568]

Details for d1u0tb_

PDB Entry: 1u0t (more details), 2.3 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis NAD kinase
PDB Compounds: (B:) Inorganic polyphosphate/ATP-NAD kinase

SCOPe Domain Sequences for d1u0tb_:

Sequence, based on SEQRES records: (download)

>d1u0tb_ e.52.1.1 (B:) Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacterium tuberculosis [TaxId: 1773]}
rsvllvvhtgrdeatetarrvekvlgdnkialrvlsaeavdrgslhlapddmramgveie
vvdadqhaadgcelvlvlggdgtflraaelarnasipvlgvnlgrigflaeaeaeaidav
lehvvaqdyrvedrltldvvvrqggrivnrgwalnevslekgprlgvlgvvveidgrpvs
afgcdgvlvstptgstayafsaggpvlwpdleailvvpnnahalfgrpmvtspeatiaie
ieadghdalvfcdgrremlipagsrlevtrcvtsvkwarldsapftdrlvrkfrlpvtgw
rgk

Sequence, based on observed residues (ATOM records): (download)

>d1u0tb_ e.52.1.1 (B:) Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacterium tuberculosis [TaxId: 1773]}
rsvllvvhtgrdeatetarrvekvlgdnkialrvlsadqhaadgcelvlvlggdgtflra
aelarnasipvlgvnlgrigflaeaeaeaidavlehvvaqdyrvedrltldvvvrqggri
vnrgwalnevslekgprlgvlgvvveidgrpvsafgcdgvlvstptgstayafsaggpvl
wpdleailvvpnnahalfgrpmvtspeatiaieieadghdalvfcdgrremlipagsrle
vtrcvtsvkwarldsapftdrlvrkfrlpvtgwrgk

SCOPe Domain Coordinates for d1u0tb_:

Click to download the PDB-style file with coordinates for d1u0tb_.
(The format of our PDB-style files is described here.)

Timeline for d1u0tb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u0ta_