SCOPe 2.07: Domain d1u0sy_: 1u0s Y:

Lineage for d1u0sy_ (1u0s Y:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Thermotoga maritima [TaxId:2336] [52177] (5 PDB entries)
   Uniprot Q56312

8. Domain d1u0sy_: 1u0s Y: [107566]
   Other proteins in same PDB: d1u0sa_

Details for d1u0sy_

PDB Entry: 1u0s, 1.9 Å

PDB Description: Chemotaxis kinase CheA P2 domain in complex with response regulator CheY from the thermophile thermotoga maritima

PDB Compounds: (Y:) Chemotaxis protein cheY

SCOPe Domain Sequences for d1u0sy_:

Sequence; same for both SEQRES and ATOM records:

>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]}
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs

Timeline for d1u0sy_:

• d1u0sy_ first appeared in SCOP 1.69
  
• d1u0sy_ appears in SCOPe 2.06
  
• d1u0sy_ appears in the current release, SCOPe 2.08