Lineage for d1u0sy_ (1u0s Y:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481070Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 481071Family c.23.1.1: CheY-related [52173] (17 proteins)
  6. 481079Protein CheY protein [52174] (4 species)
  7. 481138Species Thermotoga maritima [TaxId:243274] [52177] (5 PDB entries)
  8. 481139Domain d1u0sy_: 1u0s Y: [107566]
    Other proteins in same PDB: d1u0sa_

Details for d1u0sy_

PDB Entry: 1u0s (more details), 1.9 Å

PDB Description: Chemotaxis kinase CheA P2 domain in complex with response regulator CheY from the thermophile thermotoga maritima

SCOP Domain Sequences for d1u0sy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima}
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs

SCOP Domain Coordinates for d1u0sy_:

Click to download the PDB-style file with coordinates for d1u0sy_.
(The format of our PDB-style files is described here.)

Timeline for d1u0sy_:

Domains from other chains:
(mouse over for more information)
d1u0sa_