SCOP 1.69: Domain d1u0sy_: 1u0s Y:

Lineage for d1u0sy_ (1u0s Y:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (5 families)

5. Family c.23.1.1: CheY-related [52173] (17 proteins)

6. Protein CheY protein [52174] (4 species)

7. Species Thermotoga maritima [TaxId:243274] [52177] (5 PDB entries)

8. Domain d1u0sy_: 1u0s Y: [107566]
   Other proteins in same PDB: d1u0sa_

Details for d1u0sy_

PDB Entry: 1u0s, 1.9 Å

PDB Description: Chemotaxis kinase CheA P2 domain in complex with response regulator CheY from the thermophile thermotoga maritima

SCOP Domain Sequences for d1u0sy_:

Sequence; same for both SEQRES and ATOM records:

>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima}
gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs

Timeline for d1u0sy_:

• d1u0sy_ is new in SCOP 1.69
  
• d1u0sy_ appears in SCOP 1.71
  
• d1u0sy_ appears in the current release, SCOPe 2.08