SCOPe 2.07: Domain d1u0sa_: 1u0s A:

Lineage for d1u0sa_ (1u0s A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.24: CheY-binding domain of CheA [55052] (1 family)

5. Family d.58.24.1: CheY-binding domain of CheA [55053] (1 protein)

6. Protein CheY-binding domain of CheA [55054] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [110983] (1 PDB entry)
   Uniprot Q56310 175-260
   structurally distinct from the E.coli domain and possesses a different CheY-binding mode

8. Domain d1u0sa_: 1u0s A: [107565]
   Other proteins in same PDB: d1u0sy_

Details for d1u0sa_

PDB Entry: 1u0s, 1.9 Å

PDB Description: Chemotaxis kinase CheA P2 domain in complex with response regulator CheY from the thermophile thermotoga maritima

PDB Compounds: (A:) chemotaxis protein chea

SCOPe Domain Sequences for d1u0sa_:

Sequence; same for both SEQRES and ATOM records:

>d1u0sa_ d.58.24.1 (A:) CheY-binding domain of CheA {Thermotoga maritima [TaxId: 2336]}
gfktfyikvilkegtqlksariylvfhkleelkcevvrtipsveeieeekfenevelfvi
spvdleklsealssiadierviikev

Timeline for d1u0sa_:

• d1u0sa_ first appeared in SCOP 1.69
  
• d1u0sa_ appears in SCOPe 2.06
  
• d1u0sa_ appears in the current release, SCOPe 2.08