Lineage for d1u0sa_ (1u0s A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954540Superfamily d.58.24: CheY-binding domain of CheA [55052] (1 family) (S)
  5. 2954541Family d.58.24.1: CheY-binding domain of CheA [55053] (1 protein)
  6. 2954542Protein CheY-binding domain of CheA [55054] (2 species)
  7. 2954557Species Thermotoga maritima [TaxId:2336] [110983] (1 PDB entry)
    Uniprot Q56310 175-260
    structurally distinct from the E.coli domain and possesses a different CheY-binding mode
  8. 2954558Domain d1u0sa_: 1u0s A: [107565]
    Other proteins in same PDB: d1u0sy_

Details for d1u0sa_

PDB Entry: 1u0s (more details), 1.9 Å

PDB Description: Chemotaxis kinase CheA P2 domain in complex with response regulator CheY from the thermophile thermotoga maritima
PDB Compounds: (A:) chemotaxis protein chea

SCOPe Domain Sequences for d1u0sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0sa_ d.58.24.1 (A:) CheY-binding domain of CheA {Thermotoga maritima [TaxId: 2336]}
gfktfyikvilkegtqlksariylvfhkleelkcevvrtipsveeieeekfenevelfvi
spvdleklsealssiadierviikev

SCOPe Domain Coordinates for d1u0sa_:

Click to download the PDB-style file with coordinates for d1u0sa_.
(The format of our PDB-style files is described here.)

Timeline for d1u0sa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u0sy_