![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.24: CheY-binding domain of CheA [55052] (1 family) ![]() |
![]() | Family d.58.24.1: CheY-binding domain of CheA [55053] (1 protein) |
![]() | Protein CheY-binding domain of CheA [55054] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [110983] (1 PDB entry) Uniprot Q56310 175-260 structurally distinct from the E.coli domain and possesses a different CheY-binding mode |
![]() | Domain d1u0sa_: 1u0s A: [107565] Other proteins in same PDB: d1u0sy_ |
PDB Entry: 1u0s (more details), 1.9 Å
SCOPe Domain Sequences for d1u0sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0sa_ d.58.24.1 (A:) CheY-binding domain of CheA {Thermotoga maritima [TaxId: 2336]} gfktfyikvilkegtqlksariylvfhkleelkcevvrtipsveeieeekfenevelfvi spvdleklsealssiadierviikev
Timeline for d1u0sa_: