![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (2 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (7 proteins) |
![]() | Protein Putative polyketide synthase SCO1206 [110762] (1 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [110763] (1 PDB entry) |
![]() | Domain d1u0mb2: 1u0m B:202-349 [107560] |
PDB Entry: 1u0m (more details), 2.22 Å
SCOP Domain Sequences for d1u0mb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0mb2 c.95.1.2 (B:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor} gtgvrlerngsylipktedwimydvkatgfhflldkrvpatmeplapalkelagehgwda sdldfyivhaggprilddlstflevdphafrfsratlteygniasavvldalrrlfdegg veegargllagfgpgitaemslgcwqta
Timeline for d1u0mb2: