Lineage for d1u0mb2 (1u0m B:202-349)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. Protein Putative polyketide synthase SCO1206, C-terminal domain [419037] (1 species)
  7. Species Streptomyces coelicolor [TaxId:1902] [419521] (1 PDB entry)
    Uniprot Q9FCA7
  8. 2917261Domain d1u0mb2: 1u0m B:202-349 [107560]
    Other proteins in same PDB: d1u0ma1, d1u0mb1
    complexed with 15p, gol

Details for d1u0mb2

PDB Entry: 1u0m (more details), 2.22 Å

PDB Description: Crystal Structure of 1,3,6,8-Tetrahydroxynaphthalene Synthase (THNS) from Streptomyces coelicolor A3(2): a Bacterial Type III Polyketide Synthase (PKS) Provides Insights into Enzymatic Control of Reactive Polyketide Intermediates
PDB Compounds: (B:) putative polyketide synthase

SCOPe Domain Sequences for d1u0mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0mb2 c.95.1.2 (B:202-349) Putative polyketide synthase SCO1206, C-terminal domain {Streptomyces coelicolor [TaxId: 1902]}
gtgvrlerngsylipktedwimydvkatgfhflldkrvpatmeplapalkelagehgwda
sdldfyivhaggprilddlstflevdphafrfsratlteygniasavvldalrrlfdegg
veegargllagfgpgitaemslgcwqta

SCOPe Domain Coordinates for d1u0mb2:

Click to download the PDB-style file with coordinates for d1u0mb2.
(The format of our PDB-style files is described here.)

Timeline for d1u0mb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u0mb1